Top
EZR
Localization (UniProt annotation) Apical cell membrane Cell projection Cell projection, microvillusmembrane Cell projection, ruffle membrane Cytoplasm, cell cortex Cytoplasm, cytoskeleton Cell projection, microvillus Note=Localization to the apicalmembrane of parietal cells depends on the interaction with MPP5Localizes to cell extensions and peripheral processes ofastrocytes (By similarity) Microvillar peripheral membraneprotein (cytoplasmic side) Function (UniProt annotation) Probably involved in connections of major cytoskeletalstructures to the plasma membrane In epithelial cells, requiredfor the formation of microvilli and membrane ruffles on the apicalpole Along with PLEKHG6, required for normal macropinocytosis Catalytic Activity (UniProt annotation) N/A Protein Sequence MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKF
RAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQ
HKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLER
QQLETEKKRRETVEREKEQMMREKEELMLRLQDYEEKTKKAERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAK
EELERQAVDQIKSQEQLAAELAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEP
VSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQ
GRDKYKTLRQIRQGNTKQRIDEFEAL
EZR is dephosphorylated by following phosphatases:
Pathway ID Pathway Name Pathway Description (KEGG) hsa04530 Tight junction Tight junctions (TJs) are essential for establishing a selectively permeable barrier to diffusion through the paracellular space between neighboring cells. TJs are composed of at least three types of transmembrane protein -occludin, claudin and junctional adhesion molecules (JAMs)- and a cytoplasmic 'plaque' consisting of many different proteins that form large complexes. These are proposed to be involved in junction assembly, barrier regulation, cell polarity, gene transcription, and other pathways. hsa04670 Leukocyte transendothelial migration Leukocyte migaration from the blood into tissues is vital for immune surveillance and inflammation. During this diapedesis of leukocytes, the leukocytes bind to endothelial cell adhesion molecules (CAM) and then migrate across the vascular endothelium. A leukocyte adherent to CAMs on the endothelial cells moves forward by leading-edge protrusion and retraction of its tail. In this process, alphaL /beta2 integrin activates through Vav1, RhoA, which subsequently activates the kinase p160ROCK. ROCK activation leads to MLC phosphorylation, resulting in retraction of the actin cytoskeleton. Moreover, Leukocytes activate endothelial cell signals that stimulate endothelial cell retraction during localized dissociation of the endothelial cell junctions. ICAM-1-mediated signals activate an endothelial cell calcium flux and PKC, which are required for ICAM-1 dependent leukocyte migration. VCAM-1 is involved in the opening of the endothelial passagethrough which leukocytes can extravasate. In this regard, VCAM-1 ligation induces NADPH oxidase activation and the production of reactive oxygen species (ROS) in a Rac-mediated manner, with subsequent activation of matrix metallopoteinases and loss of VE-cadherin-mediated adhesion. hsa04810 Regulation of actin cytoskeleton hsa04971 Gastric acid secretion Gastric acid is a key factor in normal upper gastrointestinal functions, including protein digestion and calcium and iron absorption, as well as providing some protection against bacterial infections. The principal stimulants of acid secretion at the level of the parietal cell are histamine (paracrine), gastrin (hormonal), and acetycholine (ACh; neurocrine). Stimulation of acid secretion typically involves an initial elevation of intracellular calcium and cAMP, followed by activation of protein kinase cascades, which trigger the translocation of the proton pump, H+,K+-ATPase, from cytoplasmic tubulovesicles to the apical plasma membrane and thereby H+ secretion into the stomach lumen. hsa05130 Pathogenic Escherichia coli infection Enteropathogenic E. coli (EPEC) and enterohemorrhagic E. coli (EHEC) are closely related pathogenic strains of Escherichia coli. The hallmark of EPEC/EHEC infections [DS:H00278 H00277] is induction of attaching and effacing (A/E) lesions that damage intestinal epithelial cells. The capacity to form A/E lesions is encoded mainly by the locus of enterocyte effacement (LEE) pathogenicity island. Tir, Map, EspF, EspG are known LEE-encoded effector proteins secreted via the type III secretion system, which is also LEE-encoded, into the host cell. EPEC and EHEC Tir's link the extracellular bacterium to the cell cytoskeleton. Map and EspF are involved in mitochondrion membrane permeabilization. EspG interacts with tubulins and stimulates microtubule destabilization. LEE-encoded adhesin or intimin (Eae) is exported via the general secretory pathway to the periplasm, where it is inserted into the outer membrane. In addition to Tir, two potential host cell-carried intimin receptors, beta1 integrin (ITGB1) and nucleolin (NCL), have so far been identified. The distinguishing feature of EHEC is the elaboration of Shiga-like toxin (Stx). Stx cleaves ribosomal RNA, thereby disrupting protein synthesis and killing the intoxicated epithelial or endothelial cells. hsa05205 Proteoglycans in cancer Many proteoglycans (PGs) in the tumor microenvironment have been shown to be key macromolecules that contribute to biology of various types of cancer including proliferation, adhesion, angiogenesis and metastasis, affecting tumor progress. The four main types of proteoglycans include hyaluronan (HA), which does not occur as a PG but in free form, heparan sulfate proteoglycans (HSPGs), chondroitin sulfate proteoglycans (CSPGs), dematan sulfate proteoglycans (DSPG) and keratan sulfate proteoglycans (KSPGs) [BR:00535]. Among these proteoglycans such as HA, acting with CD44, promotes tumor cell growth and migration, whereas other proteoglycans such as syndecans (-1~-4), glypican (-1, -3) and perlecan may interact with growth factors, cytokines, morphogens and enzymes through HS chains [BR: 00536], also leading to tumor growth and invasion. In contrast, some of the small leucine-rich proteolgycans, such as decorin and lumican, can function as tumor repressors, and modulate the signaling pathways by the interaction of their core proteins and multiple receptors. hsa05206 MicroRNAs in cancer MicroRNA (miRNA) is a cluster of small non-encoding RNA molecules of 21 - 23 nucleotides in length, which controls gene expression post-transcriptionally either via the degradation of target mRNAs or the inhibition of protein translation. Using high-throughput profiling, dysregulation of miRNAs has been widely observed in different stages of cancer. The upregulation (overexpression) of specific miRNAs could lead to the repression of tumor suppressor gene expression, and conversely the downregulation of specific miRNAs could result in an increase of oncogene expression; both these situations induce subsequent malignant effects on cell proliferation, differentiation, and apoptosis that lead to tumor growth and progress. The miRNA signatures of cancer observed in various studies differ significantly. These inconsistencies occur due to the differences in the study populations and methodologies used. This pathway map shows the summarized results from various studies in 9 cancers, each of which is presented in a review article.
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-373752 Netrin-1 signaling. Netrins are secreted proteins that play a crucial role in neuronal migration and in axon guidance during the development of the nervous system. To date, several Netrins have been described in mouse and humans: Netrin-1, -3/NTL2, -4/h and G-Netrins. Netrin-1 is the most studied member of the family and has been shown to play a crucial role in neuronal navigation during nervous system development mainly through its interaction with its receptors DCC and UNC5. Members of the Deleted in colorectal cancer (DCC) family- which includes DCC and Neogenin in vertebrates- mediate netrin-induced axon attraction, whereas the C. elegans UNC5 receptor and its four vertebrate homologs Unc5a-Unc5d mediate repulsion R-HSA-437239 Recycling pathway of L1. L1 functions in many aspects of neuronal development including axon outgrowth and neuronal migration. These functions require coordination between L1 and the actin cytoskeleton. F-actin continuously moves in a retrograde direction from the P-(peripheral) domain of the growth cone towards the growth cone's C-(central) domain. L1, attached to the actin cytoskeleton via membrane cytoskeletal linkers (MCKs) such as ankyrins (Ankyrin-G, -B and -R) and members of the ERMs (ezrin, radixin, and moesin) family, link this retrograde F-actin flow with extracellular immobile ligands.Forward translocation of growth cone requires not only the CAM-actin linkage but also a gradient of cell substrate adhesion (strong adhesion at the front and weak adhesion at the rear) so that the cytoskeletal machinery is able to pull the cell forward as attachments at the rear are released. This asymmetry is achieved in part by internalizing L1 molecules as they are moved to the rear of the growth cone coupled to retrograde F-actin flow and recycling them to the leading edge plasma membrane.L1 internalization is mediated by phosphorylation and dephosphorylation. The L1 cytoplasmic domain (L1CD) carries an endocytic or sorting motif, YRSLE, that is recognized by the clathrin associated adaptor protein-2 (AP-2). AP-2 binds the YRSLE motif only when its tyrosine is not phosphorylated and triggers L1 endocytosis. SRC kinase associated with lipid rafts in the P-domain membrane phosphorylates L1 molecules on tyrosine-1176, stabilizing them in the plasma membrane. L1 endocytosis is triggered by the dephosphorylation of Y1176 within the C domain. Some of these internalized L1 molecules are transported in an anterograde direction along microtubules for reuse in the leading edge
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ACTN1 Co-fractionation, pull down association, physical 22939629 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct ADORA2B Affinity Capture-Western physical 12080047 , (Europe PMC )NA BioGRID AHNAK Affinity Capture-MS, pull down association, physical 14625392 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct AKR1B1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ARHGDIA Co-fractionation, Co-purification, anti bait coimmunoprecipitation, fluorescence microscopy colocalization, physical, physical association 15659383 , 20711218 , 26344197 , (Europe PMC )0.46 BioGRID, IntAct ARPC3 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID ASB6 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID AURKA Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID B4GALT7 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct BAG3 Affinity Capture-MS physical 23824909 , (Europe PMC )NA BioGRID BID Co-purification physical 15659383 , (Europe PMC )NA BioGRID BRCA1 Affinity Capture-MS, Affinity Capture-Western physical 21282464 , 26831064 , (Europe PMC )NA BioGRID CALR Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CASP10 Co-purification physical 15659383 , (Europe PMC )NA BioGRID CASP8 Co-purification physical 15659383 , (Europe PMC )NA BioGRID CD44 Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 12032545 , 20711218 , (Europe PMC )0.40 BioGRID, IntAct CDH1 Affinity Capture-Western, Proximity Label-MS physical 10462524 , 25468996 , (Europe PMC )NA BioGRID CFTR Affinity Capture-MS, Affinity Capture-Western physical 10893422 , 26618866 , (Europe PMC )NA BioGRID CLIC4 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CLIC5 Reconstituted Complex physical 10793131 , (Europe PMC )NA BioGRID CROCC Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID CTNNB1 Affinity Capture-Western physical 10462524 , (Europe PMC )NA BioGRID CUL7 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID DCC Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 20434207 , (Europe PMC )0.35 BioGRID, IntAct DGKQ Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID DLG1 Reconstituted Complex physical 11726633 , (Europe PMC )NA BioGRID DNM1L Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct ECE2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID EGFR PCA, ubiquitin reconstruction physical, physical association 24658140 , (Europe PMC )0.37 BioGRID, IntAct EIF5A2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID EIF5AL1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ELAVL1 Affinity Capture-RNA physical 19322201 , (Europe PMC )NA BioGRID ENO1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ENO2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ERBB2 Co-localization, FRET, ubiquitin reconstruction physical, physical association 24658140 , 27029001 , (Europe PMC )0.37 BioGRID, IntAct EZR Two-hybrid, proximity-dependent biotin identification, pull down, two hybrid association, physical, physical association 11285285 , 21988832 , 29568061 , 9501018 , (Europe PMC )0.72 BioGRID, IntAct, MINT FABP5 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID FADD Affinity Capture-MS, Co-localization, Co-purification, proximity ligation assay physical, physical association 15659383 , 21183682 , 25241761 , (Europe PMC )0.40 BioGRID, IntAct FAS Co-purification physical 15659383 , (Europe PMC )NA BioGRID FASLG Affinity Capture-Western, Co-purification physical 11013215 , 15659383 , (Europe PMC )NA BioGRID FBXO6 Affinity Capture-MS physical 22268729 , (Europe PMC )NA BioGRID FH Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID FKBP9 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID FN1 Affinity Capture-MS physical 19738201 , (Europe PMC )NA BioGRID FOXA1 Affinity Capture-MS physical 27926873 , (Europe PMC )NA BioGRID GABARAPL2 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct GDI2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID GNPDA1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID GPX4 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID GTF3C4 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID GZMM Biochemical Activity physical 18523284 , (Europe PMC )NA BioGRID H2AFZ Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID HEXA Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID HEXB Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID HEY1 Affinity Capture-MS physical 27129302 , (Europe PMC )NA BioGRID HLA-B Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct HSD17B10 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HSPA4 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HSPA4L Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HSPE1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HSPH1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ICAM1 Affinity Capture-Western, Reconstituted Complex physical 9705328 , (Europe PMC )NA BioGRID ICAM2 Affinity Capture-Western, Reconstituted Complex physical 9705328 , (Europe PMC )NA BioGRID ICAM3 Affinity Capture-Western, Reconstituted Complex physical 11784723 , 9705328 , (Europe PMC )NA BioGRID IPO5 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID IQGAP1 Reconstituted Complex physical 10793131 , (Europe PMC )NA BioGRID ISG15 Affinity Capture-MS physical 16009940 , (Europe PMC )NA BioGRID ISYNA1 Co-fractionation, proximity-dependent biotin identification association, physical 26344197 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct L1CAM Affinity Capture-Western, Reconstituted Complex physical 12070130 , 22846990 , (Europe PMC )NA BioGRID LASP1 Affinity Capture-MS physical 25982273 , (Europe PMC )NA BioGRID LCP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID MAPK10 Affinity Capture-MS, tandem affinity purification association, physical 23602568 , (Europe PMC )0.35 BioGRID, IntAct MAPK8 Co-purification physical 15659383 , (Europe PMC )NA BioGRID MC1R Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID MCC Affinity Capture-MS, anti bait coimmunoprecipitation, pull down physical, physical association 17353931 , 19555689 , (Europe PMC )0.59 BioGRID, IntAct, MINT MCM2 Affinity Capture-MS physical 25963833 , (Europe PMC )NA BioGRID MDM2 Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct MISP Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MPP3 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct MRPL12 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MSN Affinity Capture-MS, Affinity Capture-Western, Co-purification, Reconstituted Complex physical 15659383 , 26496610 , 7579708 , 8248180 , (Europe PMC )NA BioGRID NF2 Affinity Capture-Western, Far Western, Reconstituted Complex physical 10036239 , 17891137 , (Europe PMC )NA BioGRID NOLC1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID OAT Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID OBSL1 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID OGFOD1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID P4HB Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PALLD Far Western, Reconstituted Complex, Two-hybrid physical 11598191 , (Europe PMC )NA BioGRID PDCD10 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PDCD6IP Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PDXK Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PGD Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PHLPP2 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct PIK3R1 Affinity Capture-Western, Reconstituted Complex, pull down association, physical 10377409 , (Europe PMC )0.35 BioGRID, IntAct, MINT PLS1 Co-fractionation, proximity-dependent biotin identification association, physical 26344197 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct PLS3 Co-fractionation, proximity-dependent biotin identification association, physical 26344197 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct PPA2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PPL Affinity Capture-MS physical 14625392 , (Europe PMC )NA BioGRID PPME1 Affinity Capture-MS physical 26499835 , (Europe PMC )NA BioGRID PRKAB1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct PRKCA Affinity Capture-Western physical 11387207 , (Europe PMC )NA BioGRID PRX Affinity Capture-MS physical 14625392 , (Europe PMC )NA BioGRID PTK2 Reconstituted Complex physical 11468295 , (Europe PMC )NA BioGRID PTPRQ Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PTTG1 Synthetic Growth Defect genetic 24104479 , (Europe PMC )NA BioGRID PYGL Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID RCN1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RDX Affinity Capture-MS, Co-fractionation, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down, two hybrid fragment pooling approach association, physical, physical association 22939629 , 23414517 , 26496610 , 29568061 , (Europe PMC )0.70 BioGRID, IntAct RHOA Co-purification physical 15659383 , (Europe PMC )NA BioGRID RIC8A Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID S100P Affinity Capture-MS, Reconstituted Complex physical 12808036 , (Europe PMC )NA BioGRID SCARNA22 Affinity Capture-RNA physical 22751105 , (Europe PMC )NA BioGRID SCYL3 Two-hybrid, confocal microscopy, two hybrid physical, physical association 12651155 , (Europe PMC )0.46 BioGRID, IntAct SDC2 Affinity Capture-Western, Reconstituted Complex physical 10704377 , (Europe PMC )NA BioGRID SELL Reconstituted Complex physical 11706008 , (Europe PMC )NA BioGRID SELP Reconstituted Complex physical 10733515 , (Europe PMC )NA BioGRID SHMT2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SLC9A3R1 Affinity Capture-Western, Co-fractionation, Reconstituted Complex, affinity chromatography technology, proximity-dependent biotin identification, pull down, two hybrid fragment pooling approach association, physical, physical association 11285285 , 11684085 , 15020681 , 23414517 , 26344197 , 29568061 , 9314537 , (Europe PMC )0.76 BioGRID, IntAct, MINT SLC9A3R2 Affinity Capture-Western, Reconstituted Complex, two hybrid fragment pooling approach physical, physical association 12080047 , 23414517 , 9748260 , (Europe PMC )0.37 BioGRID, IntAct SPN Affinity Capture-Western, Reconstituted Complex physical 9616160 , (Europe PMC )NA BioGRID SPTA1 Affinity Capture-MS physical 14625392 , (Europe PMC )NA BioGRID STIP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TAGLN2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TIMM13 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TKT Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TNFRSF10B Co-purification physical 15659383 , (Europe PMC )NA BioGRID TNFRSF1A Co-purification physical 15659383 , (Europe PMC )NA BioGRID TPD52 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TPD52L2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TRIM25 Affinity Capture-RNA physical 29117863 , (Europe PMC )NA BioGRID TRNT1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID TSC1 Affinity Capture-Western physical 10806479 , (Europe PMC )NA BioGRID TSPAN33 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TXNRD2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID U2AF2 Affinity Capture-MS physical 26641092 , (Europe PMC )NA BioGRID UBA1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID UBE2R2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID UCHL3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID VCAM1 Affinity Capture-Western, Reconstituted Complex physical 12082081 , (Europe PMC )NA BioGRID VPS11 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 21148287 , (Europe PMC )NA BioGRID WDR1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID WFDC1 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct WWP1 Affinity Capture-Western physical 22629406 , (Europe PMC )NA BioGRID XPNPEP1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABCF2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ABI1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ABI2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ABR proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ACTN1 Co-fractionation, pull down association, physical 22939629 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct ACTR10 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ADD3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct AFDN proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct AHCYL2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct AHNAK Affinity Capture-MS, pull down association, physical 14625392 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct AKAP12 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct AKAP2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ANK2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ANK3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct AP2A1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ARFGAP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ARHGAP35 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ARHGDIA Co-fractionation, Co-purification, anti bait coimmunoprecipitation, fluorescence microscopy colocalization, physical, physical association 15659383 , 20711218 , 26344197 , (Europe PMC )0.46 BioGRID, IntAct ASAP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct B4GALT7 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct BAIAP2L1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct BCL11A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct BCR proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct C1orf198 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct C6orf132 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CAPN1 protease assay cleavage reaction 22805611 , (Europe PMC )0.44 IntAct, MINT CAPN6 pull down physical association 11285285 , (Europe PMC )0.40 IntAct, MINT CASK proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CAST proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CCDC124 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CD44 Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 12032545 , 20711218 , (Europe PMC )0.40 BioGRID, IntAct CNOT8 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct COBL proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct COBLL1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CTNND1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CYFIP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CYFIP2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CYLD proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DCC Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 20434207 , (Europe PMC )0.35 BioGRID, IntAct DDX18 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DDX6 pull down association 29568061 , (Europe PMC )0.35 IntAct DIP2B proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DLG1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DNM1L Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct DOCK7 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DSG2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DST proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DVL3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EBI-1059081 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct ECD proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EEF2K proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EFHD1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EGFR PCA, ubiquitin reconstruction physical, physical association 24658140 , (Europe PMC )0.37 BioGRID, IntAct EGLN1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EHBP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EIF2A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EIF4G3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ELP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ELP3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ENAH proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EPB41 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EPB41L1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EPHA2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ERBB2 Co-localization, FRET, ubiquitin reconstruction physical, physical association 24658140 , 27029001 , (Europe PMC )0.37 BioGRID, IntAct ERBIN proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EZR Two-hybrid, proximity-dependent biotin identification, pull down, two hybrid association, physical, physical association 11285285 , 21988832 , 29568061 , 9501018 , (Europe PMC )0.72 BioGRID, IntAct, MINT FADD Affinity Capture-MS, Co-localization, Co-purification, proximity ligation assay physical, physical association 15659383 , 21183682 , 25241761 , (Europe PMC )0.40 BioGRID, IntAct FAM129B proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct FAM135A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct FAM207A pull down association 29568061 , (Europe PMC )0.35 IntAct FARSB proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct FCHO2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct FERMT2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct FES anti bait coimmunoprecipitation, coimmunoprecipitation, fluorescence microscopy, pull down, two hybrid association, colocalization, direct interaction, physical association 18046454 , (Europe PMC )0.68 IntAct, MINT FTSJ3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct GAB1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct GABARAPL1 anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct GABARAPL2 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct GOLGB1 pull down association 29568061 , (Europe PMC )0.35 IntAct GPRIN1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct HAUS6 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct HDAC1 pull down association 29568061 , (Europe PMC )0.35 IntAct HGS proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct HLA-B Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct HSPA1A pull down association 29568061 , (Europe PMC )0.35 IntAct HTT two hybrid physical association 17500595 , (Europe PMC )0.37 IntAct ICAM5 pull down association 29568061 , (Europe PMC )0.35 IntAct IKBKE anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct ISYNA1 Co-fractionation, proximity-dependent biotin identification association, physical 26344197 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct ITSN1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ITSN2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KARS proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct KIAA1211 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct KIF5C proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct KLC4 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct LIMCH1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct LIN7C proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct LRBA proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct LSM1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct LYAR proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct LZTFL1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MACROD2 pull down association 29568061 , (Europe PMC )0.35 IntAct MAP3K7 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MAPK10 Affinity Capture-MS, tandem affinity purification association, physical 23602568 , (Europe PMC )0.35 BioGRID, IntAct MAPT proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MCC Affinity Capture-MS, anti bait coimmunoprecipitation, pull down physical, physical association 17353931 , 19555689 , (Europe PMC )0.59 BioGRID, IntAct, MINT MDM2 Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct MGEA5 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MPP3 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct MPRIP proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MSN anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down association 26496610 , 29568061 , (Europe PMC )0.60 IntAct MTMR1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MYH13 pull down association 29568061 , (Europe PMC )0.35 IntAct MYO1B proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MYO6 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NCKAP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NDRG1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NMT1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NOLC1 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct NOTCH2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NUMB proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NUMBL proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NUP107 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct OCRL proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct OTUB1 anti tag coimmunoprecipitation association 26752685 , (Europe PMC )0.35 IntAct PACSIN2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PAK4 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PALM2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PALMD pull down association 29568061 , (Europe PMC )0.35 IntAct PARG proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PCBP2 pull down association 29568061 , (Europe PMC )0.35 IntAct PDLIM1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PEAK1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PGAM5 pull down association 29568061 , (Europe PMC )0.35 IntAct PHACTR4 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PHLPP2 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct PIK3R1 Affinity Capture-Western, Reconstituted Complex, pull down association, physical 10377409 , (Europe PMC )0.35 BioGRID, IntAct, MINT PINX1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PKN2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PLCB3 pull down physical association 11285285 , (Europe PMC )0.40 IntAct, MINT PLEKHA1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PLEKHA7 anti bait coimmunoprecipitation association 28877994 , (Europe PMC )0.35 IntAct PLS1 Co-fractionation, proximity-dependent biotin identification association, physical 26344197 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct PLS3 Co-fractionation, proximity-dependent biotin identification association, physical 26344197 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct POLDIP3 pull down association 29568061 , (Europe PMC )0.35 IntAct PPP1R9B proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PRKAB1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct PRMT7 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PTPRQ Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct R3HCC1L proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct RABEP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct RAI14 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct RDX Affinity Capture-MS, Co-fractionation, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down, two hybrid fragment pooling approach association, physical, physical association 22939629 , 23414517 , 26496610 , 29568061 , (Europe PMC )0.70 BioGRID, IntAct RFLNB proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct RIPK2 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct RPA3 pull down association 29568061 , (Europe PMC )0.35 IntAct RPL32 pull down association 29568061 , (Europe PMC )0.35 IntAct RPS13 pull down association 29568061 , (Europe PMC )0.35 IntAct SCRIB proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SCYL3 Two-hybrid, confocal microscopy, two hybrid physical, physical association 12651155 , (Europe PMC )0.46 BioGRID, IntAct SEC16A pull down association 29568061 , (Europe PMC )0.35 IntAct SEL1L2 pull down association 29568061 , (Europe PMC )0.35 IntAct SEPT6 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SEPT8 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SGK1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct SH2D4A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SH3GLB2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SHC1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SIRT2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SKA2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SLC12A2 anti bait coimmunoprecipitation physical association 22570591 , 24555568 , (Europe PMC )0.59 IntAct SLC25A5 pull down association 29568061 , (Europe PMC )0.35 IntAct SLC9A3R1 Affinity Capture-Western, Co-fractionation, Reconstituted Complex, affinity chromatography technology, proximity-dependent biotin identification, pull down, two hybrid fragment pooling approach association, physical, physical association 11285285 , 11684085 , 15020681 , 23414517 , 26344197 , 29568061 , 9314537 , (Europe PMC )0.76 BioGRID, IntAct, MINT SLC9A3R2 Affinity Capture-Western, Reconstituted Complex, two hybrid fragment pooling approach physical, physical association 12080047 , 23414517 , 9748260 , (Europe PMC )0.37 BioGRID, IntAct SNTB1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SNTB2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SNX6 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SORBS1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SRGAP2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SRP68 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SRP72 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SVIL proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SWAP70 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SYAP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TAB1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TBC1D10A imaging technique colocalization 11285285 , (Europe PMC )0.27 IntAct, MINT TBR1 pull down association 29568061 , (Europe PMC )0.35 IntAct TCHH pull down association 29568061 , (Europe PMC )0.35 IntAct TIE1 pull down association 29568061 , (Europe PMC )0.35 IntAct TIMM13 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TIMM44 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TNIK proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TNKS1BP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TRAF6 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct TRAPPC1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TRAPPC10 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TRAPPC9 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TRIOBP proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TRMT112 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct USP1 two hybrid fragment pooling approach physical association 23414517 , (Europe PMC )0.37 IntAct USP47 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct UTRN proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct VHL anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct WASF2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct WASHC2A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct WASHC5 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct WDR44 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct WDR45 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct WFDC1 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct YWHAZ pull down physical association 15161933 , (Europe PMC )0.40 IntAct, MINT ZC3H15 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CAPN6 pull down physical association 11285285 , (Europe PMC )0.40 IntAct, MINT EZR Two-hybrid, proximity-dependent biotin identification, pull down, two hybrid association, physical, physical association 11285285 , 21988832 , 29568061 , 9501018 , (Europe PMC )0.72 BioGRID, IntAct, MINT FES anti bait coimmunoprecipitation, coimmunoprecipitation, fluorescence microscopy, pull down, two hybrid association, colocalization, direct interaction, physical association 18046454 , (Europe PMC )0.68 IntAct, MINT JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MCC Affinity Capture-MS, anti bait coimmunoprecipitation, pull down physical, physical association 17353931 , 19555689 , (Europe PMC )0.59 BioGRID, IntAct, MINT PIK3R1 Affinity Capture-Western, Reconstituted Complex, pull down association, physical 10377409 , (Europe PMC )0.35 BioGRID, IntAct, MINT PLCB3 pull down physical association 11285285 , (Europe PMC )0.40 IntAct, MINT SLC9A3R1 Affinity Capture-Western, Co-fractionation, Reconstituted Complex, affinity chromatography technology, proximity-dependent biotin identification, pull down, two hybrid fragment pooling approach association, physical, physical association 11285285 , 11684085 , 15020681 , 23414517 , 26344197 , 29568061 , 9314537 , (Europe PMC )0.76 BioGRID, IntAct, MINT TBC1D10A imaging technique colocalization 11285285 , (Europe PMC )0.27 IntAct, MINT YWHAZ pull down physical association 15161933 , (Europe PMC )0.40 IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABCF2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ABI1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ABI2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ABR proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ACAA2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ACTN1 Co-fractionation, pull down association, physical 22939629 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct ACTR10 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ADD3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ADORA2B Affinity Capture-Western physical 12080047 , (Europe PMC )NA BioGRID AFDN proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct AHCYL2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct AHNAK Affinity Capture-MS, pull down association, physical 14625392 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct AKAP12 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct AKAP2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct AKR1B1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ANK2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ANK3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct AP2A1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ARFGAP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ARHGAP35 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ARHGDIA Co-fractionation, Co-purification, anti bait coimmunoprecipitation, fluorescence microscopy colocalization, physical, physical association 15659383 , 20711218 , 26344197 , (Europe PMC )0.46 BioGRID, IntAct ARPC3 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID ASAP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ASB6 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID AURKA Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID B4GALT7 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct BAG3 Affinity Capture-MS physical 23824909 , (Europe PMC )NA BioGRID BAIAP2L1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct BCL11A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct BCR proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct BID Co-purification physical 15659383 , (Europe PMC )NA BioGRID BRCA1 Affinity Capture-MS, Affinity Capture-Western physical 21282464 , 26831064 , (Europe PMC )NA BioGRID C1orf198 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct C6orf132 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CALR Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CAPN1 protease assay cleavage reaction 22805611 , (Europe PMC )0.44 IntAct, MINT CAPN6 pull down physical association 11285285 , (Europe PMC )0.40 IntAct, MINT CASK proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CASP10 Co-purification physical 15659383 , (Europe PMC )NA BioGRID CASP8 Co-purification physical 15659383 , (Europe PMC )NA BioGRID CAST proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CCDC124 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CD44 Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 12032545 , 20711218 , (Europe PMC )0.40 BioGRID, IntAct CDH1 Affinity Capture-Western, Proximity Label-MS physical 10462524 , 25468996 , (Europe PMC )NA BioGRID CFTR Affinity Capture-MS, Affinity Capture-Western physical 10893422 , 26618866 , (Europe PMC )NA BioGRID CLIC4 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CLIC5 Reconstituted Complex physical 10793131 , (Europe PMC )NA BioGRID CNOT8 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct COBL proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct COBLL1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CROCC Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID CTNNB1 Affinity Capture-Western physical 10462524 , (Europe PMC )NA BioGRID CTNND1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CUL7 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID CYFIP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CYFIP2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct CYLD proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DCC Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 20434207 , (Europe PMC )0.35 BioGRID, IntAct DDX18 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DDX6 pull down association 29568061 , (Europe PMC )0.35 IntAct DGKQ Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID DIP2B proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DLG1 Reconstituted Complex physical 11726633 , (Europe PMC )NA BioGRID DLG1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DNM1L Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct DOCK7 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DSG2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DST proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct DVL3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EBI-1059081 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct ECD proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ECE2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID EEF2K proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EFHD1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EGFR PCA, ubiquitin reconstruction physical, physical association 24658140 , (Europe PMC )0.37 BioGRID, IntAct EGLN1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EHBP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EIF2A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EIF4G3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EIF5A2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID EIF5AL1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ELAVL1 Affinity Capture-RNA physical 19322201 , (Europe PMC )NA BioGRID ELP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ELP3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ENAH proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ENO1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ENO2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID EPB41 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EPB41L1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EPHA2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ERBB2 Co-localization, FRET, ubiquitin reconstruction physical, physical association 24658140 , 27029001 , (Europe PMC )0.37 BioGRID, IntAct ERBIN proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct EZR Two-hybrid, proximity-dependent biotin identification, pull down, two hybrid association, physical, physical association 11285285 , 21988832 , 29568061 , 9501018 , (Europe PMC )0.72 BioGRID, IntAct, MINT FABP5 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID FADD Affinity Capture-MS, Co-localization, Co-purification, proximity ligation assay physical, physical association 15659383 , 21183682 , 25241761 , (Europe PMC )0.40 BioGRID, IntAct FAM129B proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct FAM135A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct FAM207A pull down association 29568061 , (Europe PMC )0.35 IntAct FARSB proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct FAS Co-purification physical 15659383 , (Europe PMC )NA BioGRID FASLG Affinity Capture-Western, Co-purification physical 11013215 , 15659383 , (Europe PMC )NA BioGRID FBXO6 Affinity Capture-MS physical 22268729 , (Europe PMC )NA BioGRID FCHO2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct FERMT2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct FES anti bait coimmunoprecipitation, coimmunoprecipitation, fluorescence microscopy, pull down, two hybrid association, colocalization, direct interaction, physical association 18046454 , (Europe PMC )0.68 IntAct, MINT FH Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID FKBP9 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID FN1 Affinity Capture-MS physical 19738201 , (Europe PMC )NA BioGRID FOXA1 Affinity Capture-MS physical 27926873 , (Europe PMC )NA BioGRID FTSJ3 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct GAB1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct GABARAPL1 anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct GABARAPL2 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct GDI2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID GNPDA1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID GOLGB1 pull down association 29568061 , (Europe PMC )0.35 IntAct GPRIN1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct GPX4 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID GTF3C4 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID GZMM Biochemical Activity physical 18523284 , (Europe PMC )NA BioGRID H2AFZ Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID HAUS6 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct HDAC1 pull down association 29568061 , (Europe PMC )0.35 IntAct HEXA Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID HEXB Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID HEY1 Affinity Capture-MS physical 27129302 , (Europe PMC )NA BioGRID HGS proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct HLA-B Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct HSD17B10 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HSPA1A pull down association 29568061 , (Europe PMC )0.35 IntAct HSPA4 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HSPA4L Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HSPE1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HSPH1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HTT two hybrid physical association 17500595 , (Europe PMC )0.37 IntAct ICAM1 Affinity Capture-Western, Reconstituted Complex physical 9705328 , (Europe PMC )NA BioGRID ICAM2 Affinity Capture-Western, Reconstituted Complex physical 9705328 , (Europe PMC )NA BioGRID ICAM3 Affinity Capture-Western, Reconstituted Complex physical 11784723 , 9705328 , (Europe PMC )NA BioGRID ICAM5 pull down association 29568061 , (Europe PMC )0.35 IntAct IKBKE anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct IPO5 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID IQGAP1 Reconstituted Complex physical 10793131 , (Europe PMC )NA BioGRID ISG15 Affinity Capture-MS physical 16009940 , (Europe PMC )NA BioGRID ISYNA1 Co-fractionation, proximity-dependent biotin identification association, physical 26344197 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct ITSN1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct ITSN2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KARS proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct KIAA1211 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct KIF5C proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct KLC4 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct L1CAM Affinity Capture-Western, Reconstituted Complex physical 12070130 , 22846990 , (Europe PMC )NA BioGRID LASP1 Affinity Capture-MS physical 25982273 , (Europe PMC )NA BioGRID LCP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID LIMCH1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct LIN7C proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct LRBA proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct LSM1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct LYAR proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct LZTFL1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MACROD2 pull down association 29568061 , (Europe PMC )0.35 IntAct MAP3K7 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MAPK10 Affinity Capture-MS, tandem affinity purification association, physical 23602568 , (Europe PMC )0.35 BioGRID, IntAct MAPK8 Co-purification physical 15659383 , (Europe PMC )NA BioGRID MAPT proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MC1R Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID MCC Affinity Capture-MS, anti bait coimmunoprecipitation, pull down physical, physical association 17353931 , 19555689 , (Europe PMC )0.59 BioGRID, IntAct, MINT MCM2 Affinity Capture-MS physical 25963833 , (Europe PMC )NA BioGRID MDM2 Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct MGEA5 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MISP Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MPP3 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct MPRIP proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MRPL12 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MSN Affinity Capture-MS, Affinity Capture-Western, Co-purification, Reconstituted Complex physical 15659383 , 26496610 , 7579708 , 8248180 , (Europe PMC )NA BioGRID MSN anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down association 26496610 , 29568061 , (Europe PMC )0.60 IntAct MTMR1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MYH13 pull down association 29568061 , (Europe PMC )0.35 IntAct MYO1B proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MYO6 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NCKAP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NDRG1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NF2 Affinity Capture-Western, Far Western, Reconstituted Complex physical 10036239 , 17891137 , (Europe PMC )NA BioGRID NMT1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NOLC1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID NOLC1 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct NOTCH2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID NUMB proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NUMBL proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct NUP107 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct OAT Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID OBSL1 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID OCRL proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct OGFOD1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID OTUB1 anti tag coimmunoprecipitation association 26752685 , (Europe PMC )0.35 IntAct P4HB Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PACSIN2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PAK4 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PALLD Far Western, Reconstituted Complex, Two-hybrid physical 11598191 , (Europe PMC )NA BioGRID PALM2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PALMD pull down association 29568061 , (Europe PMC )0.35 IntAct PARG proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PCBP2 pull down association 29568061 , (Europe PMC )0.35 IntAct PDCD10 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PDCD6IP Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PDLIM1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PDXK Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PEAK1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PGAM5 pull down association 29568061 , (Europe PMC )0.35 IntAct PGD Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PHACTR4 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PHLPP2 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct PIK3R1 Affinity Capture-Western, Reconstituted Complex, pull down association, physical 10377409 , (Europe PMC )0.35 BioGRID, IntAct, MINT PINX1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PKN2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PLCB3 pull down physical association 11285285 , (Europe PMC )0.40 IntAct, MINT PLEKHA1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PLEKHA7 anti bait coimmunoprecipitation association 28877994 , (Europe PMC )0.35 IntAct PLS1 Co-fractionation, proximity-dependent biotin identification association, physical 26344197 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct PLS3 Co-fractionation, proximity-dependent biotin identification association, physical 26344197 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct POLDIP3 pull down association 29568061 , (Europe PMC )0.35 IntAct PPA2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PPL Affinity Capture-MS physical 14625392 , (Europe PMC )NA BioGRID PPME1 Affinity Capture-MS physical 26499835 , (Europe PMC )NA BioGRID PPP1R9B proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PRKAB1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct PRKCA Affinity Capture-Western physical 11387207 , (Europe PMC )NA BioGRID PRMT7 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct PRX Affinity Capture-MS physical 14625392 , (Europe PMC )NA BioGRID PTK2 Reconstituted Complex physical 11468295 , (Europe PMC )NA BioGRID PTPRQ Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PTTG1 Synthetic Growth Defect genetic 24104479 , (Europe PMC )NA BioGRID PYGL Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID R3HCC1L proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct RABEP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct RAI14 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct RCN1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RDX Affinity Capture-MS, Co-fractionation, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down, two hybrid fragment pooling approach association, physical, physical association 22939629 , 23414517 , 26496610 , 29568061 , (Europe PMC )0.70 BioGRID, IntAct RFLNB proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct RHOA Co-purification physical 15659383 , (Europe PMC )NA BioGRID RIC8A Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID RIPK2 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct RPA3 pull down association 29568061 , (Europe PMC )0.35 IntAct RPL32 pull down association 29568061 , (Europe PMC )0.35 IntAct RPS13 pull down association 29568061 , (Europe PMC )0.35 IntAct S100P Affinity Capture-MS, Reconstituted Complex physical 12808036 , (Europe PMC )NA BioGRID SCARNA22 Affinity Capture-RNA physical 22751105 , (Europe PMC )NA BioGRID SCRIB proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SCYL3 Two-hybrid, confocal microscopy, two hybrid physical, physical association 12651155 , (Europe PMC )0.46 BioGRID, IntAct SDC2 Affinity Capture-Western, Reconstituted Complex physical 10704377 , (Europe PMC )NA BioGRID SEC16A pull down association 29568061 , (Europe PMC )0.35 IntAct SEL1L2 pull down association 29568061 , (Europe PMC )0.35 IntAct SELL Reconstituted Complex physical 11706008 , (Europe PMC )NA BioGRID SELP Reconstituted Complex physical 10733515 , (Europe PMC )NA BioGRID SEPT6 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SEPT8 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SGK1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct SH2D4A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SH3GLB2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SHC1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SHMT2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SIRT2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SKA2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SLC12A2 anti bait coimmunoprecipitation physical association 22570591 , 24555568 , (Europe PMC )0.59 IntAct SLC25A5 pull down association 29568061 , (Europe PMC )0.35 IntAct SLC9A3R1 Affinity Capture-Western, Co-fractionation, Reconstituted Complex, affinity chromatography technology, proximity-dependent biotin identification, pull down, two hybrid fragment pooling approach association, physical, physical association 11285285 , 11684085 , 15020681 , 23414517 , 26344197 , 29568061 , 9314537 , (Europe PMC )0.76 BioGRID, IntAct, MINT SLC9A3R2 Affinity Capture-Western, Reconstituted Complex, two hybrid fragment pooling approach physical, physical association 12080047 , 23414517 , 9748260 , (Europe PMC )0.37 BioGRID, IntAct SNTB1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SNTB2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SNX6 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SORBS1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SPN Affinity Capture-Western, Reconstituted Complex physical 9616160 , (Europe PMC )NA BioGRID SPTA1 Affinity Capture-MS physical 14625392 , (Europe PMC )NA BioGRID SRGAP2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SRP68 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SRP72 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct STIP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SVIL proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SWAP70 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct SYAP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TAB1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TAGLN2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TBC1D10A imaging technique colocalization 11285285 , (Europe PMC )0.27 IntAct, MINT TBR1 pull down association 29568061 , (Europe PMC )0.35 IntAct TCHH pull down association 29568061 , (Europe PMC )0.35 IntAct TIE1 pull down association 29568061 , (Europe PMC )0.35 IntAct TIMM13 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TIMM44 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TKT Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TNFRSF10B Co-purification physical 15659383 , (Europe PMC )NA BioGRID TNFRSF1A Co-purification physical 15659383 , (Europe PMC )NA BioGRID TNIK proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TNKS1BP1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TPD52 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TPD52L2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TRAF6 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct TRAPPC1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TRAPPC10 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TRAPPC9 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TRIM25 Affinity Capture-RNA physical 29117863 , (Europe PMC )NA BioGRID TRIOBP proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TRMT112 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct TRNT1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID TSC1 Affinity Capture-Western physical 10806479 , (Europe PMC )NA BioGRID TSPAN33 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TXNRD2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID U2AF2 Affinity Capture-MS physical 26641092 , (Europe PMC )NA BioGRID UBA1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID UBE2R2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID UCHL3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID USP1 two hybrid fragment pooling approach physical association 23414517 , (Europe PMC )0.37 IntAct USP47 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct UTRN proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct VCAM1 Affinity Capture-Western, Reconstituted Complex physical 12082081 , (Europe PMC )NA BioGRID VHL anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct VPS11 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 21148287 , (Europe PMC )NA BioGRID WASF2 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct WASHC2A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct WASHC5 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct WDR1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID WDR44 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct WDR45 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct WFDC1 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct WWP1 Affinity Capture-Western physical 22629406 , (Europe PMC )NA BioGRID XPNPEP1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID YWHAZ pull down physical association 15161933 , (Europe PMC )0.40 IntAct, MINT ZC3H15 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
AKT2 T567_QGRDKYKtLRQIRQG , NA NA PhosphoSitePlus , CDK5 T235_YEKDDKLtPKIGFPW , in vitro, in vivo 12769842 ,(Europe PMC )HPRD, EGFR Y146_KEVHKSGyLSSERLI , Y354_LMLRLQDyEEKTKKA , LTP, in vitro, in vivo 12560083 , 1382070 ,(Europe PMC )HPRD, PhosphoELM , PhosphoSitePlus , FER Y146_KEVHKSGyLSSERLI , Y354_LMLRLQDyEEKTKKA , Y478_PPPPPPVyEPVSYHV , NA NA PhosphoSitePlus , GRK-2 T567_QGRDKYKtLRQIRQG , LTP 15843435 ,(Europe PMC )PhosphoELM , GRK2 T567_QGRDKYKtLRQIRQG , NA NA PhosphoSitePlus , LCK Y146_KEVHKSGyLSSERLI , in vitro, in vivo 12560083 , 1382070 ,(Europe PMC )HPRD, PhosphoSitePlus , LRRK2 T567_QGRDKYKtLRQIRQG , NA NA PhosphoSitePlus , Lck Y146_KEVHKSGyLSSERLI , LTP 12560083 ,(Europe PMC )PhosphoELM , MAP3K8 T567_QGRDKYKtLRQIRQG , NA NA PhosphoSitePlus , MAP4K4 T567_QGRDKYKtLRQIRQG , NA NA PhosphoSitePlus , PKB_beta T567_QGRDKYKtLRQIRQG , LTP 15531580 ,(Europe PMC )PhosphoELM , PRKACA S66_LKLDKKVsAQEVRKE , NA NA PhosphoSitePlus , PRKCA T567_QGRDKYKtLRQIRQG , in vivo 10970850 , 11387207 ,(Europe PMC )HPRD, PhosphoSitePlus , PRKCI T567_QGRDKYKtLRQIRQG , NA NA PhosphoSitePlus , PRKCQ T567_QGRDKYKtLRQIRQG , NA NA PhosphoSitePlus , ROCK1 T567_QGRDKYKtLRQIRQG , LTP, in vivo 10970850 , 11387207 , 19255442 , 19386264 ,(Europe PMC )HPRD, PhosphoELM , PhosphoSitePlus , SRC Y146_KEVHKSGyLSSERLI , Y478_PPPPPPVyEPVSYHV , LTP 15623525 ,(Europe PMC )PhosphoELM , PhosphoSitePlus , STK10 T567_QGRDKYKtLRQIRQG , NA NA PhosphoSitePlus , STK26 T567_QGRDKYKtLRQIRQG , NA NA PhosphoSitePlus , Unknown S536_RQLLTLSsELSQARD , S539_LTLSSELsQARDENK , T567_QGRDKYKtLRQIRQG , LTP, in vivo 14504278 , 18212344 , 19664994 ,(Europe PMC )HPRD, PhosphoELM ,